PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB01G14200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 119aa    MW: 13628 Da    PI: 10.1063
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB01G14200.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.36.4e-171764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+  +++ G  tW+++a+  g++R++k+c++rw +yl
     OB01G14200.1 17 KGLWSPEEDERLYTHITRCGVSTWSSVAQLAGLRRSGKSCRLRWMNYL 64
                     678*******************************************97 PP

2Myb_DNA-binding452.5e-1472113346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      + T  E e +v + k+lG++ W+ Ia++m+ gRt++++k++w++
     OB01G14200.1  72 PITDREAETIVSLQKLLGNR-WSVIAAKMP-GRTDNEIKNYWNS 113
                      67999***************.*********.***********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.8991268IPR017930Myb domain
SuperFamilySSF466894.12E-2816111IPR009057Homeodomain-like
SMARTSM007171.6E-111666IPR001005SANT/Myb domain
PfamPF002491.1E-141764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-211871IPR009057Homeodomain-like
CDDcd001672.32E-82064No hitNo description
PROSITE profilePS5129415.69769119IPR017930Myb domain
SMARTSM007173.1E-1269117IPR001005SANT/Myb domain
PfamPF002491.6E-1172113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-2272117IPR009057Homeodomain-like
CDDcd001675.54E-872112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 119 aa     Download sequence    Send to blast
EAESGEAAAA AAEKERKGLW SPEEDERLYT HITRCGVSTW SSVAQLAGLR RSGKSCRLRW  60
MNYLRPDLKK EPITDREAET IVSLQKLLGN RWSVIAAKMP GRTDNEIKNY WNSRIRKXX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-271711727126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015694952.13e-80PREDICTED: myb-related protein Hv33-like
SwissprotP200272e-48MYB3_HORVU; Myb-related protein Hv33
TrEMBLJ3KWR44e-81J3KWR4_ORYBR; Uncharacterized protein
STRINGOB01G14200.11e-80(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP87032545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.18e-46myb domain protein 61